SCOPe 2.07: Domain d1vf3a1: 1vf3 A:4-80

Lineage for d1vf3a1 (1vf3 A:4-80)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (188 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225005] (4 PDB entries)

8. Domain d1vf3a1: 1vf3 A:4-80 [202948]
   Other proteins in same PDB: d1vf3a2, d1vf3b2
   automated match to d1f3ba2
   complexed with acy, gdn

Details for d1vf3a1

PDB Entry: 1vf3, 2.15 Å

PDB Description: cgsta1-1 in complex with glutathione conjugate of cdnb

PDB Compounds: (A:) Glutathione S-transferase 3

SCOPe Domain Sequences for d1vf3a1:

Sequence; same for both SEQRES and ATOM records:

>d1vf3a1 c.47.1.0 (A:4-80) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
kpvlyyfngrgkmesirwllaaagvefeevfletreqyekllqsgilmfqqvpmveidgm
klvqtrailnyiagkyn

Timeline for d1vf3a1:

• d1vf3a1 first appeared in SCOPe 2.03
  
• d1vf3a1 appears in SCOPe 2.06
  
• d1vf3a1 appears in the current release, SCOPe 2.08