SCOPe 2.08: Domain d1vf2b2: 1vf2 B:1081-1228

Lineage for d1vf2b2 (1vf2 B:1081-1228)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225006] (4 PDB entries)

8. Domain d1vf2b2: 1vf2 B:1081-1228 [202947]
   Other proteins in same PDB: d1vf2a1, d1vf2b1
   automated match to d1f3aa1
   complexed with gtx, zn

Details for d1vf2b2

PDB Entry: 1vf2, 2.15 Å

PDB Description: cgsta1-1 in complex with s-hexyl-glutathione

PDB Compounds: (B:) Glutathione S-transferase 3

SCOPe Domain Sequences for d1vf2b2:

Sequence; same for both SEQRES and ATOM records:

>d1vf2b2 a.45.1.0 (B:1081-1228) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lygkdlkeralidmyvggtddlmgfllsfpflsaedkvkqcafvvekatsryfpayekvl
kdhgqdflvgnrlswadihlleailmveekksdalsgfpllqafkkrissiptikkflap
gskrkpisddkyvetvrrvlrmyydvkp

Timeline for d1vf2b2:

• d1vf2b2 first appeared in SCOPe 2.03
  
• d1vf2b2 appears in SCOPe 2.07