| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein automated matches [190803] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188070] (21 PDB entries) |
| Domain d1vdga2: 1vdg A:98-197 [202939] automated match to d1g0xa2 |
PDB Entry: 1vdg (more details), 2.8 Å
SCOPe Domain Sequences for d1vdga2:
Sequence, based on SEQRES records: (download)
>d1vdga2 b.1.1.4 (A:98-197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayikptlsaqpspvvnsggnvilqcdsqvafdgfslckegedehpqclnsqphargssra
ifsvgpvspsrrwwyrcyaydsnspyewslpsdllellvl
>d1vdga2 b.1.1.4 (A:98-197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayikptlsaqpspvvnsggnvilqcdsqvafdgfslckeqclnsqphargssraifsvgp
vspsrrwwyrcyaydsnspyewslpsdllellvl
Timeline for d1vdga2: