SCOPe 2.08: Domain d1vdga2: 1vdg A:98-197

Lineage for d1vdga2 (1vdg A:98-197)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)

8. Domain d1vdga2: 1vdg A:98-197 [202939]
   automated match to d1g0xa2

Details for d1vdga2

PDB Entry: 1vdg, 2.8 Å

PDB Description: Crystal structure of LIR1.01, one of the alleles of LIR1

PDB Compounds: (A:) Leukocyte immunoglobulin-like receptor subfamily B member 1

SCOPe Domain Sequences for d1vdga2:

Sequence, based on SEQRES records:

>d1vdga2 b.1.1.4 (A:98-197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayikptlsaqpspvvnsggnvilqcdsqvafdgfslckegedehpqclnsqphargssra
ifsvgpvspsrrwwyrcyaydsnspyewslpsdllellvl

Sequence, based on observed residues (ATOM records):

>d1vdga2 b.1.1.4 (A:98-197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ayikptlsaqpspvvnsggnvilqcdsqvafdgfslckeqclnsqphargssraifsvgp
vspsrrwwyrcyaydsnspyewslpsdllellvl

Timeline for d1vdga2:

• d1vdga2 first appeared in SCOPe 2.03
  
• d1vdga2 appears in SCOPe 2.07