SCOPe 2.05: Domain d1vdga1: 1vdg A:1-97

Lineage for d1vdga1 (1vdg A:1-97)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein automated matches [190803] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188070] (27 PDB entries)

8. Domain d1vdga1: 1vdg A:1-97 [202938]
   automated match to d1g0xa1

Details for d1vdga1

PDB Entry: 1vdg, 2.8 Å

PDB Description: Crystal structure of LIR1.01, one of the alleles of LIR1

PDB Compounds: (A:) Leukocyte immunoglobulin-like receptor subfamily B member 1

SCOPe Domain Sequences for d1vdga1:

Sequence, based on SEQRES records:

>d1vdga1 b.1.1.4 (A:1-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghlpkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktalwitripqelvkkgqf
pipsitwehagryrcyygsdtagrsessdplelvvtg

Sequence, based on observed residues (ATOM records):

>d1vdga1 b.1.1.4 (A:1-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghlpkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktalwitripqelvkkgqf
pipsitwehagryrcyyggrsessdplelvvtg

Timeline for d1vdga1:

• d1vdga1 first appeared in SCOPe 2.03
  
• d1vdga1 appears in SCOPe 2.04
  
• d1vdga1 appears in SCOPe 2.06
  
• d1vdga1 appears in the current release, SCOPe 2.08