Lineage for d1vdga1 (1vdg A:1-97)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753968Protein automated matches [190803] (3 species)
    not a true protein
  7. 2753969Species Human (Homo sapiens) [TaxId:9606] [188070] (29 PDB entries)
  8. 2754017Domain d1vdga1: 1vdg A:1-97 [202938]
    automated match to d1g0xa1

Details for d1vdga1

PDB Entry: 1vdg (more details), 2.8 Å

PDB Description: Crystal structure of LIR1.01, one of the alleles of LIR1
PDB Compounds: (A:) Leukocyte immunoglobulin-like receptor subfamily B member 1

SCOPe Domain Sequences for d1vdga1:

Sequence, based on SEQRES records: (download)

>d1vdga1 b.1.1.4 (A:1-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghlpkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktalwitripqelvkkgqf
pipsitwehagryrcyygsdtagrsessdplelvvtg

Sequence, based on observed residues (ATOM records): (download)

>d1vdga1 b.1.1.4 (A:1-97) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ghlpkptlwaepgsvitqgspvtlrcqggqetqeyrlyrekktalwitripqelvkkgqf
pipsitwehagryrcyyggrsessdplelvvtg

SCOPe Domain Coordinates for d1vdga1:

Click to download the PDB-style file with coordinates for d1vdga1.
(The format of our PDB-style files is described here.)

Timeline for d1vdga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vdga2