Lineage for d1v9na_ (1v9n A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150779Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily)
    core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest
  4. 2150780Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (2 families) (S)
    topological similarity to the domain 2 of TM1585
    automatically mapped to Pfam PF02615
  5. 2150832Family c.122.1.0: automated matches [227150] (1 protein)
    not a true family
  6. 2150833Protein automated matches [226854] (5 species)
    not a true protein
  7. 2150851Species Pyrococcus horikoshii OT3 [TaxId:70601] [224967] (1 PDB entry)
  8. 2150852Domain d1v9na_: 1v9n A: [202937]
    automated match to d1s20f_
    complexed with gol, ndp

Details for d1v9na_

PDB Entry: 1v9n (more details), 2.1 Å

PDB Description: Structure of Malate Dehydrogenase from Pyrococcus horikoshii OT3
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d1v9na_:

Sequence, based on SEQRES records: (download)

>d1v9na_ c.122.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mfekgyvdenyirvpkdrlfsfivrvltklgvpeedakivadnlvmadlrgveshgvqrl
kryvdgiisggvnlhpkirviregpsyalidgdeglgqvvgyrsmklaikkakdtgigiv
iarnsnhygiagyyalmaaeegmigismtnsrplvaptggierilgtnpialaaptkdkp
flldmatsvvpigklevyrrkgkdipegwainregnittkveevfnggallplggfgell
gghkgyglslmvdilsgilsggtwskyvkntsekgsnvchffmvidiehfipleefkeki
sqmieeikssrkhpeferiwihgekgfltmetrlklgipiyrkvleelneiakrvgvegl

Sequence, based on observed residues (ATOM records): (download)

>d1v9na_ c.122.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mfekgyvdenyirvpkdrlfsfivrvltklgvpeedakivadnlvmadlrgveshgvqrl
kryvdgiisggvnlhpkirviregpsyalidgdeglgqvvgyrsmklaikkakdtgigiv
iarnsnhygiagyyalmaaeegmigismtnsrplvaptggierilgtnpialaaptkdkp
flldmatsvvpigklewainregnittkveevfnggallplggfgellgghkgyglslmv
dilsgilsggtwskyvkntsekgsnvchffmvidiehfipleefkekisqmieeikssrk
hpeferiwihgekgfltmetrlklgipiyrkvleelneiakrvgvegl

SCOPe Domain Coordinates for d1v9na_:

Click to download the PDB-style file with coordinates for d1v9na_.
(The format of our PDB-style files is described here.)

Timeline for d1v9na_: