Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (21 species) not a true protein |
Species Carp (Cyprinus carpio) [TaxId:7962] [224962] (1 PDB entry) |
Domain d1v6aa2: 1v6a A:161-332 [202934] Other proteins in same PDB: d1v6aa1, d1v6ab1 automated match to d9ldta2 complexed with tre |
PDB Entry: 1v6a (more details), 2.3 Å
SCOPe Domain Sequences for d1v6aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v6aa2 d.162.1.0 (A:161-332) automated matches {Carp (Cyprinus carpio) [TaxId: 7962]} sgtnldsarfrhlmgeklgihpsnchgwvigehgdssvpvwsgvnvagvflqglnpdmgt dkdkedwksvhkmvvdsayeviklkgytswaigmsaadlcqsilknlrkchpvstlvkgm hgvneevflsvpcilgnsgltdvvhmtlksdeekqlvksaetlwgvqkdltl
Timeline for d1v6aa2: