SCOPe 2.07: Domain d1v6aa1: 1v6a A:1-160

Lineage for d1v6aa1 (1v6a A:1-160)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (309 species)
   not a true protein

7. Species Carp (Cyprinus carpio) [TaxId:7962] [224961] (1 PDB entry)

8. Domain d1v6aa1: 1v6a A:1-160 [202933]
   Other proteins in same PDB: d1v6aa2, d1v6ab2
   automated match to d9ldta1
   complexed with tre

Details for d1v6aa1

PDB Entry: 1v6a, 2.3 Å

PDB Description: crystal structure of l-lactate dehydrogenase from cyprinus carpio

PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d1v6aa1:

Sequence; same for both SEQRES and ATOM records:

>d1v6aa1 c.2.1.0 (A:1-160) automated matches {Carp (Cyprinus carpio) [TaxId: 7962]}
astkeklithvskeepagptnkvtvvgvgmvgmaaaisillkdltdelalvdvmedklkg
eamdlqhgslflkthkivadkdysvtanskvvvvtagarqqegesrlnlvqrnvnifkfi
ipniikyspncillvvsnpvdiltyvawklsglprnrvig

Timeline for d1v6aa1:

• d1v6aa1 first appeared in SCOPe 2.03
  
• d1v6aa1 appears in SCOPe 2.06
  
• d1v6aa1 appears in the current release, SCOPe 2.08