SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1v6aa1 (1v6a A:1-160)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (220 species)
    not a true protein
  7. 2094683Species Carp (Cyprinus carpio) [TaxId:7962] [224961] (1 PDB entry)
  8. 2094684Domain d1v6aa1: 1v6a A:1-160 [202933]
    Other proteins in same PDB: d1v6aa2, d1v6ab2
    automated match to d9ldta1
    complexed with tre

Details for d1v6aa1

PDB Entry: 1v6a (more details), 2.3 Å

PDB Description: Crystal Structure of L-lactate dehydrogenase from Cyprinus carpio
PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d1v6aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v6aa1 c.2.1.0 (A:1-160) automated matches {Carp (Cyprinus carpio) [TaxId: 7962]}
astkeklithvskeepagptnkvtvvgvgmvgmaaaisillkdltdelalvdvmedklkg
eamdlqhgslflkthkivadkdysvtanskvvvvtagarqqegesrlnlvqrnvnifkfi
ipniikyspncillvvsnpvdiltyvawklsglprnrvig

SCOPe Domain Coordinates for d1v6aa1:

Click to download the PDB-style file with coordinates for d1v6aa1.
(The format of our PDB-style files is described here.)

Timeline for d1v6aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v6aa2