SCOPe 2.06: Domain d1u2pa_: 1u2p A:

Lineage for d1u2pa_ (1u2p A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (17 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [193848] (3 PDB entries)

8. Domain d1u2pa_: 1u2p A: [202923]
   automated match to d1u2qa_
   complexed with cl

Details for d1u2pa_

PDB Entry: 1u2p, 1.9 Å

PDB Description: Crystal structure of Mycobacterium tuberculosis Low Molecular Protein Tyrosine Phosphatase (MPtpA) at 1.9A resolution

PDB Compounds: (A:) low molecular weight protein-tyrosine-phosphatase

SCOPe Domain Sequences for d1u2pa_:

Sequence; same for both SEQRES and ATOM records:

>d1u2pa_ c.44.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
plhvtfvctgnicrspmaekmfaqqlrhrglgdavrvtsagtgnwhvgscaderaagvlr
ahgyptdhraaqvgtehlaadllvaldrnharllrqlgveaarvrmlrsfdprsgthald
vedpyygdhsdfeevfaviesalpglhdwvderlar

Timeline for d1u2pa_:

• d1u2pa_ first appeared in SCOPe 2.03
  
• d1u2pa_ appears in SCOPe 2.05
  
• d1u2pa_ appears in SCOPe 2.07
  
• d1u2pa_ appears in the current release, SCOPe 2.08