Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) share the common active site structure with the family II |
Family c.44.1.0: automated matches [191415] (1 protein) not a true family |
Protein automated matches [190574] (17 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [193848] (3 PDB entries) |
Domain d1u2pa_: 1u2p A: [202923] automated match to d1u2qa_ complexed with cl |
PDB Entry: 1u2p (more details), 1.9 Å
SCOPe Domain Sequences for d1u2pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1u2pa_ c.44.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} plhvtfvctgnicrspmaekmfaqqlrhrglgdavrvtsagtgnwhvgscaderaagvlr ahgyptdhraaqvgtehlaadllvaldrnharllrqlgveaarvrmlrsfdprsgthald vedpyygdhsdfeevfaviesalpglhdwvderlar
Timeline for d1u2pa_: