SCOPe 2.04: Domain d1tdib2: 1tdi B:81-221

Lineage for d1tdib2 (1tdi B:81-221)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (35 PDB entries)

8. Domain d1tdib2: 1tdi B:81-221 [202920]
   Other proteins in same PDB: d1tdia1, d1tdib1
   automated match to d1agsa1
   complexed with gsh

Details for d1tdib2

PDB Entry: 1tdi, 2.4 Å

PDB Description: Crystal Structure of hGSTA3-3 in Complex with Glutathione

PDB Compounds: (B:) Glutathione S-transferase A3-3

SCOPe Domain Sequences for d1tdib2:

Sequence; same for both SEQRES and ATOM records:

>d1tdib2 a.45.1.1 (B:81-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lygkdikeralidmytegmadlnemilllplcrpeekdakialikektksryfpafekvl
qshgqdylvgnklsradislvellyyveeldsslisnfpllkalktrisnlptvkkflqp
gsprkppadakaleearkifr

Timeline for d1tdib2:

• d1tdib2 first appeared in SCOPe 2.03
  
• d1tdib2 appears in SCOPe 2.05
  
• d1tdib2 appears in the current release, SCOPe 2.08