Lineage for d1tdib2 (1tdi B:81-221)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713569Species Human (Homo sapiens) [TaxId:9606] [224956] (38 PDB entries)
  8. 2713681Domain d1tdib2: 1tdi B:81-221 [202920]
    Other proteins in same PDB: d1tdia1, d1tdib1
    automated match to d1agsa1
    complexed with gsh

Details for d1tdib2

PDB Entry: 1tdi (more details), 2.4 Å

PDB Description: Crystal Structure of hGSTA3-3 in Complex with Glutathione
PDB Compounds: (B:) Glutathione S-transferase A3-3

SCOPe Domain Sequences for d1tdib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdib2 a.45.1.1 (B:81-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lygkdikeralidmytegmadlnemilllplcrpeekdakialikektksryfpafekvl
qshgqdylvgnklsradislvellyyveeldsslisnfpllkalktrisnlptvkkflqp
gsprkppadakaleearkifr

SCOPe Domain Coordinates for d1tdib2:

Click to download the PDB-style file with coordinates for d1tdib2.
(The format of our PDB-style files is described here.)

Timeline for d1tdib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tdib1