Lineage for d1qful1 (1qfu L:1-106B)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287841Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (98 PDB entries)
  8. 287937Domain d1qful1: 1qfu L:1-106B [20292]
    Other proteins in same PDB: d1qfua_, d1qfub_, d1qfuh1, d1qfuh2, d1qful2
    part of Influenza virus hemagglutinin-neutralizing Fab
    complexed with man, nag

Details for d1qful1

PDB Entry: 1qfu (more details), 2.8 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody
PDB Compounds: (L:)

SCOP Domain Sequences for d1qful1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qful1 b.1.1.1 (L:1-106B) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1}
dvvmtqtplslpvslgdqasiscrssqtlvhsngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqnthvpytfgggtkleik

SCOP Domain Coordinates for d1qful1:

Click to download the PDB-style file with coordinates for d1qful1.
(The format of our PDB-style files is described here.)

Timeline for d1qful1: