Lineage for d1tdib1 (1tdi B:4-80)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487517Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)
  8. 2487767Domain d1tdib1: 1tdi B:4-80 [202919]
    Other proteins in same PDB: d1tdia2, d1tdib2
    automated match to d1k3ya2
    complexed with gsh

Details for d1tdib1

PDB Entry: 1tdi (more details), 2.4 Å

PDB Description: Crystal Structure of hGSTA3-3 in Complex with Glutathione
PDB Compounds: (B:) Glutathione S-transferase A3-3

SCOPe Domain Sequences for d1tdib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tdib1 c.47.1.0 (B:4-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
klvqtrailnyiaskyn

SCOPe Domain Coordinates for d1tdib1:

Click to download the PDB-style file with coordinates for d1tdib1.
(The format of our PDB-style files is described here.)

Timeline for d1tdib1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tdib2