Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries) |
Domain d1tdia1: 1tdi A:4-80 [202917] Other proteins in same PDB: d1tdia2, d1tdib2 automated match to d1k3ya2 complexed with gsh |
PDB Entry: 1tdi (more details), 2.4 Å
SCOPe Domain Sequences for d1tdia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tdia1 c.47.1.0 (A:4-80) automated matches {Human (Homo sapiens) [TaxId: 9606]} kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm klvqtrailnyiaskyn
Timeline for d1tdia1: