SCOPe 2.08: Domain d1tdia1: 1tdi A:4-80

Lineage for d1tdia1 (1tdi A:4-80)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d1tdia1: 1tdi A:4-80 [202917]
   Other proteins in same PDB: d1tdia2, d1tdib2
   automated match to d1k3ya2
   complexed with gsh

Details for d1tdia1

PDB Entry: 1tdi, 2.4 Å

PDB Description: Crystal Structure of hGSTA3-3 in Complex with Glutathione

PDB Compounds: (A:) Glutathione S-transferase A3-3

SCOPe Domain Sequences for d1tdia1:

Sequence; same for both SEQRES and ATOM records:

>d1tdia1 c.47.1.0 (A:4-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpklhyfngrgrmepirwllaaagvefeekfigsaedlgklrndgslmfqqvpmveidgm
klvqtrailnyiaskyn

Timeline for d1tdia1:

• d1tdia1 first appeared in SCOPe 2.03
  
• d1tdia1 appears in SCOPe 2.07