Lineage for d1t90c_ (1t90 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141154Species Bacillus subtilis [TaxId:1423] [196003] (2 PDB entries)
  8. 2141159Domain d1t90c_: 1t90 C: [202915]
    automated match to d1o9ja_
    complexed with nad

Details for d1t90c_

PDB Entry: 1t90 (more details), 2.5 Å

PDB Description: crystal structure of methylmalonate semialdehyde dehydrogenase from bacillus subtilis
PDB Compounds: (C:) Probable methylmalonate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1t90c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t90c_ c.82.1.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
eirklknyingewvesktdqyedvvnpatkevlcqvpistkedidyaaqtaaeafktwsk
vavprrarilfnfqqllsqhkeelahlitiengkntkealgevgrgienvefaagapslm
mgdslasiatdveaanyrypigvvggiapfnfpmmvpcwmfpmaialgntfilkpsertp
llteklvelfekaglpkgvfnvvygahdvvngilehpeikaisfvgskpvgeyvykkgse
nlkrvqsltgaknhtivlndanledtvtnivgaafgsagercmacavvtveegiadefma
klqekvadikignglddgvflgpvirednkkrtlsyiekgleegarlvcdgrenvsddgy
fvgptifdnvttemtiwkdeifapvlsvirvknlkeaieianksefangaclftsnsnai
ryfrenidagmlginlgvpapmaffpfsgwkssffgtlhangkdsvdfytrkkvvtaryp
apdf

SCOPe Domain Coordinates for d1t90c_:

Click to download the PDB-style file with coordinates for d1t90c_.
(The format of our PDB-style files is described here.)

Timeline for d1t90c_: