Lineage for d1oakh1 (1oak H:215-336)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7821Species Fab NMC-4 (mouse), kappa L chain [48860] (2 PDB entries)
  8. 7824Domain d1oakh1: 1oak H:215-336 [20291]
    Other proteins in same PDB: d1oaka_, d1oakh2, d1oakl2

Details for d1oakh1

PDB Entry: 1oak (more details), 2.2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain in complex with the function blocking nmc-4 fab

SCOP Domain Sequences for d1oakh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oakh1 b.1.1.1 (H:215-336) Immunoglobulin (variable domains of L and H chains) {Fab NMC-4 (mouse), kappa L chain}
qvqlaesgpglvapsqslsitctvsgfsltdygvdwvrqppgkglewlgmiwgdgstdyn
salksrlsitkdnsksqvflkmnslqtddtaryycvrdpadygnydyaldywgqgtsvtv
ss

SCOP Domain Coordinates for d1oakh1:

Click to download the PDB-style file with coordinates for d1oakh1.
(The format of our PDB-style files is described here.)

Timeline for d1oakh1: