Lineage for d1suja1 (1suj A:5-173)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376007Species Ambystoma tigrinum [TaxId:8305] [225004] (1 PDB entry)
  8. 2376008Domain d1suja1: 1suj A:5-173 [202906]
    automated match to d1cf1b1

Details for d1suja1

PDB Entry: 1suj (more details), 2.38 Å

PDB Description: X-ray crystal structure of ambystoma tigrinum cone arrestin
PDB Compounds: (A:) cone arrestin

SCOPe Domain Sequences for d1suja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1suja1 b.1.18.0 (A:5-173) automated matches {Ambystoma tigrinum [TaxId: 8305]}
skvykktcpnaklsiylgkrdfvdhvehvepvdgvvlidpeylkdrkvfvtltcafrygr
ddldligmsfrkdlyslatqvyppetkepltplqeklmkklgahaypfcfkmgtnlpcsv
tlqpgpddtgkscgvdfevkafcaenleekihkrnsvqlvirkvqfapa

SCOPe Domain Coordinates for d1suja1:

Click to download the PDB-style file with coordinates for d1suja1.
(The format of our PDB-style files is described here.)

Timeline for d1suja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1suja2