SCOPe 2.05: Domain d1smkh2: 1smk H:189-356

Lineage for d1smkh2 (1smk H:189-356)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (26 species)
   not a true protein

7. Species Citrullus lanatus [TaxId:3654] [224959] (2 PDB entries)

8. Domain d1smkh2: 1smk H:189-356 [202905]
   Other proteins in same PDB: d1smka1, d1smkb1, d1smkc1, d1smkd1, d1smke1, d1smkf1, d1smkg1, d1smkh1
   automated match to d1mlda2
   complexed with cit

Details for d1smkh2

PDB Entry: 1smk, 2.5 Å

PDB Description: Mature and translocatable forms of glyoxysomal malate dehydrogenase have different activities and stabilities but similar crystal structures

PDB Compounds: (H:) Malate dehydrogenase, glyoxysomal

SCOPe Domain Sequences for d1smkh2:

Sequence; same for both SEQRES and ATOM records:

>d1smkh2 d.162.1.0 (H:189-356) automated matches {Citrullus lanatus [TaxId: 3654]}
vtmldvvrantfvaevlgldprdvdvpvvgghagvtilpllsqvkppssftqeeisyltd
riqnggtevveakagagsatlsmayaavkfadaclrglrgdagviecafvssqvtelpff
askvrlgrngieevyslgplneyeriglekakkelagsiekgvsfirs

Timeline for d1smkh2:

• d1smkh2 first appeared in SCOPe 2.03
  
• d1smkh2 appears in SCOPe 2.04
  
• d1smkh2 appears in SCOPe 2.06
  
• d1smkh2 appears in the current release, SCOPe 2.08