Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
Protein automated matches [226850] (24 species) not a true protein |
Species Citrullus lanatus [TaxId:3654] [224959] (2 PDB entries) |
Domain d1smke2: 1smk E:189-356 [202899] Other proteins in same PDB: d1smka1, d1smkb1, d1smkc1, d1smkd1, d1smke1, d1smkf1, d1smkg1, d1smkh1 automated match to d1mlda2 complexed with cit |
PDB Entry: 1smk (more details), 2.5 Å
SCOPe Domain Sequences for d1smke2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smke2 d.162.1.0 (E:189-356) automated matches {Citrullus lanatus [TaxId: 3654]} vtmldvvrantfvaevlgldprdvdvpvvgghagvtilpllsqvkppssftqeeisyltd riqnggtevveakagagsatlsmayaavkfadaclrglrgdagviecafvssqvtelpff askvrlgrngieevyslgplneyeriglekakkelagsiekgvsfirs
Timeline for d1smke2: