Lineage for d1smke1 (1smk E:44-188)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846530Species Citrullus lanatus [TaxId:3654] [224958] (2 PDB entries)
  8. 2846535Domain d1smke1: 1smk E:44-188 [202898]
    Other proteins in same PDB: d1smka2, d1smkb2, d1smkc2, d1smkd2, d1smke2, d1smkf2, d1smkg2, d1smkh2
    automated match to d1mlda1
    complexed with cit

Details for d1smke1

PDB Entry: 1smk (more details), 2.5 Å

PDB Description: Mature and translocatable forms of glyoxysomal malate dehydrogenase have different activities and stabilities but similar crystal structures
PDB Compounds: (E:) Malate dehydrogenase, glyoxysomal

SCOPe Domain Sequences for d1smke1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smke1 c.2.1.0 (E:44-188) automated matches {Citrullus lanatus [TaxId: 3654]}
gfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgavvrgflgq
qqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccpraivnlisnp
vnstvpiaaevfkkagtydpkrllg

SCOPe Domain Coordinates for d1smke1:

Click to download the PDB-style file with coordinates for d1smke1.
(The format of our PDB-style files is described here.)

Timeline for d1smke1: