| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Citrullus lanatus [TaxId:3654] [224958] (2 PDB entries) |
| Domain d1smkc1: 1smk C:44-188 [202894] Other proteins in same PDB: d1smka2, d1smkb2, d1smkc2, d1smkd2, d1smke2, d1smkf2, d1smkg2, d1smkh2 automated match to d1mlda1 complexed with cit |
PDB Entry: 1smk (more details), 2.5 Å
SCOPe Domain Sequences for d1smkc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smkc1 c.2.1.0 (C:44-188) automated matches {Citrullus lanatus [TaxId: 3654]}
gfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgavvrgflgq
qqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccpraivnlisnp
vnstvpiaaevfkkagtydpkrllg
Timeline for d1smkc1: