Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Citrullus lanatus [TaxId:3654] [224958] (2 PDB entries) |
Domain d1smkb1: 1smk B:44-188 [202892] Other proteins in same PDB: d1smka2, d1smkb2, d1smkc2, d1smkd2, d1smke2, d1smkf2, d1smkg2, d1smkh2 automated match to d1mlda1 complexed with cit |
PDB Entry: 1smk (more details), 2.5 Å
SCOPe Domain Sequences for d1smkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smkb1 c.2.1.0 (B:44-188) automated matches {Citrullus lanatus [TaxId: 3654]} gfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgavvrgflgq qqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccpraivnlisnp vnstvpiaaevfkkagtydpkrllg
Timeline for d1smkb1: