SCOPe 2.07: Domain d1fnsh1: 1fns H:215-336

Lineage for d1fnsh1 (1fns H:215-336)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)

8. Domain d1fnsh1: 1fns H:215-336 [20289]
   Other proteins in same PDB: d1fnsa1, d1fnsa2, d1fnsh2, d1fnsl1, d1fnsl2
   part of Fab NMC-4 blocking the von willebrand factor (vwf) a1 domain function
   mutant

Details for d1fnsh1

PDB Entry: 1fns, 2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4

PDB Compounds: (H:) immunoglobulin nmc-4 igg1

SCOPe Domain Sequences for d1fnsh1:

Sequence; same for both SEQRES and ATOM records:

>d1fnsh1 b.1.1.1 (H:215-336) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
qvqlkesgpglvapsqslsitctvsgfsltdygvdwvrqppgkglewlgmiwgdgstdyn
salksrlsitkdnsksqvflkmnslqtddtaryycvrdpadygnydyaldywgqgtsvtv
ss

Timeline for d1fnsh1:

• d1fnsh1 first appeared (with stable ids) in SCOP 1.55
  
• d1fnsh1 appears in SCOPe 2.06
  
• d1fnsh1 appears in the current release, SCOPe 2.08