Lineage for d1fnsh1 (1fns H:215-336)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52501Species Fab NMC-4 (mouse), kappa L chain [48860] (2 PDB entries)
  8. 52502Domain d1fnsh1: 1fns H:215-336 [20289]
    Other proteins in same PDB: d1fnsa_, d1fnsh2, d1fnsl2

Details for d1fnsh1

PDB Entry: 1fns (more details), 2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4

SCOP Domain Sequences for d1fnsh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnsh1 b.1.1.1 (H:215-336) Immunoglobulin (variable domains of L and H chains) {Fab NMC-4 (mouse), kappa L chain}
qvqlkesgpglvapsqslsitctvsgfsltdygvdwvrqppgkglewlgmiwgdgstdyn
salksrlsitkdnsksqvflkmnslqtddtaryycvrdpadygnydyaldywgqgtsvtv
ss

SCOP Domain Coordinates for d1fnsh1:

Click to download the PDB-style file with coordinates for d1fnsh1.
(The format of our PDB-style files is described here.)

Timeline for d1fnsh1: