SCOP 1.55: Domain d1fnsh1: 1fns H:215-336

Lineage for d1fnsh1 (1fns H:215-336)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab NMC-4 (mouse), kappa L chain [48860] (2 PDB entries)

8. Domain d1fnsh1: 1fns H:215-336 [20289]
   Other proteins in same PDB: d1fnsa_, d1fnsh2, d1fnsl2

Details for d1fnsh1

PDB Entry: 1fns, 2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4

SCOP Domain Sequences for d1fnsh1:

Sequence; same for both SEQRES and ATOM records:

>d1fnsh1 b.1.1.1 (H:215-336) Immunoglobulin (variable domains of L and H chains) {Fab NMC-4 (mouse), kappa L chain}
qvqlkesgpglvapsqslsitctvsgfsltdygvdwvrqppgkglewlgmiwgdgstdyn
salksrlsitkdnsksqvflkmnslqtddtaryycvrdpadygnydyaldywgqgtsvtv
ss

Timeline for d1fnsh1:

• d1fnsh1 appears in SCOP 1.57
  
• d1fnsh1 appears in the current release, SCOPe 2.08