Lineage for d1sevb2 (1sev B:189-356)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1939262Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1939263Protein automated matches [226850] (26 species)
    not a true protein
  7. 1939320Species Citrullus lanatus [TaxId:3654] [224959] (2 PDB entries)
  8. 1939330Domain d1sevb2: 1sev B:189-356 [202889]
    Other proteins in same PDB: d1seva1, d1sevb1
    automated match to d1mlda2

Details for d1sevb2

PDB Entry: 1sev (more details), 2.55 Å

PDB Description: Mature and translocatable forms of glyoxysomal malate dehydrogenase have different activities and stabilities but similar crystal structures
PDB Compounds: (B:) Malate dehydrogenase, glyoxysomal precursor

SCOPe Domain Sequences for d1sevb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sevb2 d.162.1.0 (B:189-356) automated matches {Citrullus lanatus [TaxId: 3654]}
vtmldvvrantfvaevlgldprdvdvpvvgghagvtilpllsqvkppssftqeeisyltd
riqnggtevveakagagsatlsmayaavkfadaclrglrgdagviecafvssqvtelpff
askvrlgrngieevyslgplneyeriglekakkelagsiekgvsfirs

SCOPe Domain Coordinates for d1sevb2:

Click to download the PDB-style file with coordinates for d1sevb2.
(The format of our PDB-style files is described here.)

Timeline for d1sevb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sevb1