SCOPe 2.06: Domain d1sevb1: 1sev B:44-188

Lineage for d1sevb1 (1sev B:44-188)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Citrullus lanatus [TaxId:3654] [224958] (2 PDB entries)

8. Domain d1sevb1: 1sev B:44-188 [202888]
   Other proteins in same PDB: d1seva2, d1sevb2
   automated match to d1mlda1

Details for d1sevb1

PDB Entry: 1sev, 2.55 Å

PDB Description: Mature and translocatable forms of glyoxysomal malate dehydrogenase have different activities and stabilities but similar crystal structures

PDB Compounds: (B:) Malate dehydrogenase, glyoxysomal precursor

SCOPe Domain Sequences for d1sevb1:

Sequence; same for both SEQRES and ATOM records:

>d1sevb1 c.2.1.0 (B:44-188) automated matches {Citrullus lanatus [TaxId: 3654]}
gfkvailgaaggigqplamlmkmnplvsvlhlydvvnapgvtadishmdtgavvrgflgq
qqleaaltgmdliivpagvprkpgmtrddlfkinagivktlcegiakccpraivnlisnp
vnstvpiaaevfkkagtydpkrllg

Timeline for d1sevb1:

• d1sevb1 first appeared in SCOPe 2.03
  
• d1sevb1 appears in SCOPe 2.05
  
• d1sevb1 appears in SCOPe 2.07
  
• d1sevb1 appears in the current release, SCOPe 2.08