SCOPe 2.08: Domain d1seva2: 1sev A:189-356

Lineage for d1seva2 (1sev A:189-356)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (47 species)
   not a true protein

7. Species Citrullus lanatus [TaxId:3654] [224959] (2 PDB entries)

8. Domain d1seva2: 1sev A:189-356 [202887]
   Other proteins in same PDB: d1seva1, d1sevb1
   automated match to d1mlda2

Details for d1seva2

PDB Entry: 1sev, 2.55 Å

PDB Description: Mature and translocatable forms of glyoxysomal malate dehydrogenase have different activities and stabilities but similar crystal structures

PDB Compounds: (A:) Malate dehydrogenase, glyoxysomal precursor

SCOPe Domain Sequences for d1seva2:

Sequence; same for both SEQRES and ATOM records:

>d1seva2 d.162.1.0 (A:189-356) automated matches {Citrullus lanatus [TaxId: 3654]}
vtmldvvrantfvaevlgldprdvdvpvvgghagvtilpllsqvkppssftqeeisyltd
riqnggtevveakagagsatlsmayaavkfadaclrglrgdagviecafvssqvtelpff
askvrlgrngieevyslgplneyeriglekakkelagsiekgvsfirs

Timeline for d1seva2:

• d1seva2 first appeared in SCOPe 2.03
  
• d1seva2 appears in SCOPe 2.07