SCOPe 2.05: Domain d1seql1: 1seq L:1-106A

Lineage for d1seql1 (1seq L:1-106A)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d1seql1: 1seq L:1-106A [202884]
   Other proteins in same PDB: d1seql2
   automated match to d1dqdl1
   complexed with ipa, so4, trs

Details for d1seql1

PDB Entry: 1seq, 1.78 Å

PDB Description: fab mnac13

PDB Compounds: (L:) Monoclonal Antibody MNAC13

SCOPe Domain Sequences for d1seql1:

Sequence; same for both SEQRES and ATOM records:

>d1seql1 b.1.1.0 (L:1-106A) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaimsaslgssvtltcsasssvsymhwyqqksgtspvlliyttsnlasgvpsr
fsgsgsgtfysltissveasdaadyychqwssypwtfgggtkleik

Timeline for d1seql1:

• d1seql1 first appeared in SCOPe 2.03
  
• d1seql1 appears in SCOPe 2.04
  
• d1seql1 appears in SCOPe 2.06
  
• d1seql1 appears in the current release, SCOPe 2.08