Lineage for d1s4ic_ (1s4i C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2764467Family b.1.8.0: automated matches [191527] (1 protein)
    not a true family
  6. 2764468Protein automated matches [190890] (7 species)
    not a true protein
  7. 2764469Species Bacillus subtilis [TaxId:1423] [224973] (4 PDB entries)
  8. 2764474Domain d1s4ic_: 1s4i C: [202882]
    automated match to d1do5d_
    complexed with cl, zn

Details for d1s4ic_

PDB Entry: 1s4i (more details), 1.8 Å

PDB Description: Crystal structure of a SOD-like protein from Bacillus subtilis
PDB Compounds: (C:) superoxide dismutase-like protein yojM

SCOPe Domain Sequences for d1s4ic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s4ic_ b.1.8.0 (C:) automated matches {Bacillus subtilis [TaxId: 1423]}
afghhvqlvnregkavgfieikesddegldihisanslrpgaslgfhiyekgscvrpdfe
saggpfnplnkehgfnnpmghhagdlpnlevgadgkvdvimnapdtslkkgsklnilded
gsafiiheqaddyltnpsgnsgarivcgall

SCOPe Domain Coordinates for d1s4ic_:

Click to download the PDB-style file with coordinates for d1s4ic_.
(The format of our PDB-style files is described here.)

Timeline for d1s4ic_: