Lineage for d1s4ia_ (1s4i A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2373677Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2374430Family b.1.8.0: automated matches [191527] (1 protein)
    not a true family
  6. 2374431Protein automated matches [190890] (7 species)
    not a true protein
  7. 2374432Species Bacillus subtilis [TaxId:1423] [224973] (4 PDB entries)
  8. 2374435Domain d1s4ia_: 1s4i A: [202880]
    automated match to d1do5d_
    complexed with cl, zn

Details for d1s4ia_

PDB Entry: 1s4i (more details), 1.8 Å

PDB Description: Crystal structure of a SOD-like protein from Bacillus subtilis
PDB Compounds: (A:) superoxide dismutase-like protein yojM

SCOPe Domain Sequences for d1s4ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s4ia_ b.1.8.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
afghhvqlvnregkavgfieikesddegldihisanslrpgaslgfhiyekgscvrpdfe
saggpfnplnkehgfnnpmghhagdlpnlevgadgkvdvimnapdtslkkgsklnilded
gsafiiheqaddyltnpsgnsgarivcgall

SCOPe Domain Coordinates for d1s4ia_:

Click to download the PDB-style file with coordinates for d1s4ia_.
(The format of our PDB-style files is described here.)

Timeline for d1s4ia_: