SCOPe 2.05: Domain d1s4ia_: 1s4i A:

Lineage for d1s4ia_ (1s4i A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.0: automated matches [191527] (1 protein)
   not a true family

6. Protein automated matches [190890] (5 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [224973] (4 PDB entries)

8. Domain d1s4ia_: 1s4i A: [202880]
   automated match to d1do5d_
   complexed with cl, zn

Details for d1s4ia_

PDB Entry: 1s4i, 1.8 Å

PDB Description: Crystal structure of a SOD-like protein from Bacillus subtilis

PDB Compounds: (A:) superoxide dismutase-like protein yojM

SCOPe Domain Sequences for d1s4ia_:

Sequence; same for both SEQRES and ATOM records:

>d1s4ia_ b.1.8.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
afghhvqlvnregkavgfieikesddegldihisanslrpgaslgfhiyekgscvrpdfe
saggpfnplnkehgfnnpmghhagdlpnlevgadgkvdvimnapdtslkkgsklnilded
gsafiiheqaddyltnpsgnsgarivcgall

Timeline for d1s4ia_:

• d1s4ia_ first appeared in SCOPe 2.03
  
• d1s4ia_ appears in SCOPe 2.04
  
• d1s4ia_ appears in SCOPe 2.06
  
• d1s4ia_ appears in the current release, SCOPe 2.08