![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.0: automated matches [191527] (1 protein) not a true family |
![]() | Protein automated matches [190890] (7 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:1423] [224973] (4 PDB entries) |
![]() | Domain d1s4ia_: 1s4i A: [202880] automated match to d1do5d_ complexed with cl, zn |
PDB Entry: 1s4i (more details), 1.8 Å
SCOPe Domain Sequences for d1s4ia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s4ia_ b.1.8.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} afghhvqlvnregkavgfieikesddegldihisanslrpgaslgfhiyekgscvrpdfe saggpfnplnkehgfnnpmghhagdlpnlevgadgkvdvimnapdtslkkgsklnilded gsafiiheqaddyltnpsgnsgarivcgall
Timeline for d1s4ia_: