Lineage for d1fnsl1 (1fns L:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219905Species Fab NMC-4 (mouse), kappa L chain [48860] (2 PDB entries)
    the von willebrand factor (vwf) a1 domain function blocking
  8. 219907Domain d1fnsl1: 1fns L:1-107 [20288]
    Other proteins in same PDB: d1fnsa_, d1fnsh2, d1fnsl2

Details for d1fnsl1

PDB Entry: 1fns (more details), 2 Å

PDB Description: crystal structure of the von willebrand factor (vwf) a1 domain i546v mutant in complex with the function blocking fab nmc4
PDB Compounds: (L:)

SCOP Domain Sequences for d1fnsl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnsl1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Fab NMC-4 (mouse), kappa L chain}
diqmtqspsslsaslgdrvtiscsasqdinkylnwyqqkpdgavkllifytsslhsgvps
rfsgsgsgtdysltisnlepediatyycqqyeklpwtfgggtklevk

SCOP Domain Coordinates for d1fnsl1:

Click to download the PDB-style file with coordinates for d1fnsl1.
(The format of our PDB-style files is described here.)

Timeline for d1fnsl1: