Lineage for d5ldhb2 (5ldh B:163-331)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2604674Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2604681Protein Lactate dehydrogenase [56339] (20 species)
  7. 2605022Species Pig (Sus scrofa) [TaxId:9823] [56340] (3 PDB entries)
  8. 2605028Domain d5ldhb2: 5ldh B:163-331 [202878]
    Other proteins in same PDB: d5ldha1, d5ldhb1
    automated match to d5ldha2
    complexed with cit, lnc

Details for d5ldhb2

PDB Entry: 5ldh (more details), 2.7 Å

PDB Description: structure of the active ternary complex of pig heart lactate dehydrogenase with s-lac-nad at 2.7 angstroms resolution
PDB Compounds: (B:) lactate dehydrogenase

SCOPe Domain Sequences for d5ldhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ldhb2 d.162.1.1 (B:163-331) Lactate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
sgcnldsarfrylmgeklgvhpsschgwilgehgdssvavwsgvnvagvvlqqlnpemgt
dndsenwkevhkmvvesayeviklkgytnwaiglsvadliesmlknlsrihpvstmvqgm
ygienevflslpcvlnargltsvinqklkddevaqlknsadtlwgiqkdlkdl

SCOPe Domain Coordinates for d5ldhb2:

Click to download the PDB-style file with coordinates for d5ldhb2.
(The format of our PDB-style files is described here.)

Timeline for d5ldhb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ldhb1