SCOPe 2.04: Domain d5ldhb2: 5ldh B:163-331

Lineage for d5ldhb2 (5ldh B:163-331)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (19 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [56340] (3 PDB entries)

8. Domain d5ldhb2: 5ldh B:163-331 [202878]
   Other proteins in same PDB: d5ldha1, d5ldhb1
   automated match to d5ldha2
   complexed with cit, lnc

Details for d5ldhb2

PDB Entry: 5ldh, 2.7 Å

PDB Description: structure of the active ternary complex of pig heart lactate dehydrogenase with s-lac-nad at 2.7 angstroms resolution

PDB Compounds: (B:) lactate dehydrogenase

SCOPe Domain Sequences for d5ldhb2:

Sequence; same for both SEQRES and ATOM records:

>d5ldhb2 d.162.1.1 (B:163-331) Lactate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]}
sgcnldsarfrylmgeklgvhpsschgwilgehgdssvavwsgvnvagvvlqqlnpemgt
dndsenwkevhkmvvesayeviklkgytnwaiglsvadliesmlknlsrihpvstmvqgm
ygienevflslpcvlnargltsvinqklkddevaqlknsadtlwgiqkdlkdl

Timeline for d5ldhb2:

• d5ldhb2 first appeared in SCOPe 2.03
  
• d5ldhb2 appears in SCOPe 2.05
  
• d5ldhb2 appears in the current release, SCOPe 2.08