SCOP 1.73: Domain d1a0qh1: 1a0q H:2-114

Lineage for d1a0qh1 (1a0q H:2-114)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1a0qh1: 1a0q H:2-114 [20287]
   Other proteins in same PDB: d1a0qh2, d1a0ql1, d1a0ql2
   part of catalytic antibody 29G11 with esterase activity
   complexed with hep, zn

Details for d1a0qh1

PDB Entry: 1a0q, 2.3 Å

PDB Description: 29g11 complexed with phenyl [1-(1-n-succinylamino)pentyl] phosphonate

PDB Compounds: (H:) 29g11 fab (heavy chain)

SCOP Domain Sequences for d1a0qh1:

Sequence, based on SEQRES records:

>d1a0qh1 b.1.1.1 (H:2-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
vqlqesdaelvkpgasvkisckasgytftdhvihwvkqkpeqglewigyispgngdikyn
ekfkgkatltadkssstaymqlnsltsedsavylckrgyygrsnvdywgqgttltvssa

Sequence, based on observed residues (ATOM records):

>d1a0qh1 b.1.1.1 (H:2-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
vqlqesdaelvkpgasvkisckasgytftdhvihwvkqkpeqglewigyispgngdikyn
ekfkgkatltadkssstaymqlnsltsedsavylckrgyyvdywgqgttltvssa

Timeline for d1a0qh1:

• d1a0qh1 first appeared (with stable ids) in SCOP 1.55
  
• d1a0qh1 appears in SCOP 1.71
  
• d1a0qh1 appears in SCOP 1.75
  
• d1a0qh1 appears in the current release, SCOPe 2.08