Lineage for d1a0qh1 (1a0q H:2-114)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451214Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)
  8. 451284Domain d1a0qh1: 1a0q H:2-114 [20287]
    Other proteins in same PDB: d1a0qh2, d1a0ql1, d1a0ql2
    part of catalytic antibody 29G11 with esterase activity

Details for d1a0qh1

PDB Entry: 1a0q (more details), 2.3 Å

PDB Description: 29g11 complexed with phenyl [1-(1-n-succinylamino)pentyl] phosphonate

SCOP Domain Sequences for d1a0qh1:

Sequence, based on SEQRES records: (download)

>d1a0qh1 b.1.1.1 (H:2-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
vqlqesdaelvkpgasvkisckasgytftdhvihwvkqkpeqglewigyispgngdikyn
ekfkgkatltadkssstaymqlnsltsedsavylckrgyygrsnvdywgqgttltvssa

Sequence, based on observed residues (ATOM records): (download)

>d1a0qh1 b.1.1.1 (H:2-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
vqlqesdaelvkpgasvkisckasgytftdhvihwvkqkpeqglewigyispgngdikyn
ekfkgkatltadkssstaymqlnsltsedsavylckrgyyvdywgqgttltvssa

SCOP Domain Coordinates for d1a0qh1:

Click to download the PDB-style file with coordinates for d1a0qh1.
(The format of our PDB-style files is described here.)

Timeline for d1a0qh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a0qh2