Lineage for d4kq6d_ (4kq6 D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2113861Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2113862Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2113863Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 2114022Protein automated matches [190461] (5 species)
    not a true protein
  7. 2114029Species Candida glabrata [TaxId:284593] [193568] (2 PDB entries)
  8. 2114043Domain d4kq6d_: 4kq6 D: [202868]
    complexed with dlz, gol, so4

Details for d4kq6d_

PDB Entry: 4kq6 (more details), 2.24 Å

PDB Description: Product complex of lumazine synthase from candida glabrata
PDB Compounds: (D:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d4kq6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kq6d_ c.16.1.1 (D:) automated matches {Candida glabrata [TaxId: 284593]}
vkglgqldqnydgsklrvgiiharwnrviidalvkgaidrmlslgvkeeniivetvpgsf
elpygskrfaekqakkgepldvvipigvlikgstmhfeyisdsttqaimnlqdkinipvi
fglltclteeqalaragidegktmhnhgedwgaaavematkfgan

SCOPe Domain Coordinates for d4kq6d_:

Click to download the PDB-style file with coordinates for d4kq6d_.
(The format of our PDB-style files is described here.)

Timeline for d4kq6d_: