Class b: All beta proteins [48724] (176 folds) |
Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily) 11 stranded sheet partly folded in a corner-like structure filled with a few short helices |
Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) |
Family b.125.1.1: Outer-membrane lipoproteins carrier protein LolA [89393] (2 proteins) automatically mapped to Pfam PF03548 |
Protein automated matches [190946] (2 species) not a true protein |
Species Yersinia pestis [TaxId:547048] [197117] (1 PDB entry) |
Domain d4ki3i_: 4ki3 I: [202859] automated match to d4ki3a_ complexed with act, gol, peg |
PDB Entry: 4ki3 (more details), 1.7 Å
SCOPe Domain Sequences for d4ki3i_:
Sequence, based on SEQRES records: (download)
>d4ki3i_ b.125.1.1 (I:) automated matches {Yersinia pestis [TaxId: 547048]} dastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdesvli sdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltpksa sgnlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtlddq r
>d4ki3i_ b.125.1.1 (I:) automated matches {Yersinia pestis [TaxId: 547048]} dastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdesvli sdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltpksa gnlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtlddqr
Timeline for d4ki3i_: