Lineage for d4ki3h_ (4ki3 H:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1564850Fold b.125: LolA-like prokaryotic lipoproteins and lipoprotein localization factors [89391] (1 superfamily)
    11 stranded sheet partly folded in a corner-like structure filled with a few short helices
  4. 1564851Superfamily b.125.1: Prokaryotic lipoproteins and lipoprotein localization factors [89392] (4 families) (S)
  5. 1564852Family b.125.1.1: Outer-membrane lipoproteins carrier protein LolA [89393] (2 proteins)
    automatically mapped to Pfam PF03548
  6. 1564858Protein automated matches [190946] (2 species)
    not a true protein
  7. 1564862Species Yersinia pestis [TaxId:547048] [197117] (1 PDB entry)
  8. 1564870Domain d4ki3h_: 4ki3 H: [202858]
    automated match to d4ki3a_
    complexed with act, gol, peg

Details for d4ki3h_

PDB Entry: 4ki3 (more details), 1.7 Å

PDB Description: 1.70 angstrom resolution crystal structure of outer-membrane lipoprotein carrier protein (lola) from yersinia pestis co92
PDB Compounds: (H:) Outer-membrane lipoprotein carrier protein

SCOPe Domain Sequences for d4ki3h_:

Sequence, based on SEQRES records: (download)

>d4ki3h_ b.125.1.1 (H:) automated matches {Yersinia pestis [TaxId: 547048]}
dastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdesvli
sdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltpksa
sgnlkqfaisvtpsgtiksftaveqdgqrsaytlksqqssvvdaskftftppkgvtlddq
r

Sequence, based on observed residues (ATOM records): (download)

>d4ki3h_ b.125.1.1 (H:) automated matches {Yersinia pestis [TaxId: 547048]}
dastdlqnrlskvnsfhasfsqavtssdgavvqegegelwvkrpnlfnwhmtspdesvli
sdgetlwfynpfveqatatwlknatgntpfmlitrnnpddwkqynvkqkgddfeltpksa
nlkqfaisvtpsgtiksftaveqdgqrsaytlksaskftftppkgvtlddqr

SCOPe Domain Coordinates for d4ki3h_:

Click to download the PDB-style file with coordinates for d4ki3h_.
(The format of our PDB-style files is described here.)

Timeline for d4ki3h_: