SCOPe 2.07: Domain d4kgng_: 4kgn G:

Lineage for d4kgng_ (4kgn G:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.0: automated matches [191557] (1 protein)
   not a true family

6. Protein automated matches [190961] (16 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:425067] [188581] (2 PDB entries)

8. Domain d4kgng_: 4kgn G: [202849]
   Other proteins in same PDB: d4kgnc2, d4kgnd2, d4kgnf2
   automated match to d3e5ya_
   complexed with cl, sah

Details for d4kgng_

PDB Entry: 4kgn, 2.15 Å

PDB Description: Crystal structure of a tRNA (cytidine(34)-2'-O)-methyltransferase bound to S-adenosyl homocysteine

PDB Compounds: (G:) tRNA (cytidine(34)-2'-O)-methyltransferase

SCOPe Domain Sequences for d4kgng_:

Sequence, based on SEQRES records:

>d4kgng_ c.116.1.0 (G:) automated matches {Burkholderia pseudomallei [TaxId: 425067]}
mfnvvlvepeippntgnvirlcantgarlhlieplgfplddakmrragldyheyaqmrvh
rdwdafvaaeapdparmfafttrgsgrfhdrafepgdwfvfgaetrglapalvdrfapeq
rvrlpmrpgnrslnlsntvavvvfeawrqagfegga

Sequence, based on observed residues (ATOM records):

>d4kgng_ c.116.1.0 (G:) automated matches {Burkholderia pseudomallei [TaxId: 425067]}
mfnvvlvepeippntgnvirlcantgarlhlieplgfplgldyheyaqmrvhrdwdafva
aeapdparmfafttrgsgrfhdrafepgdwfvfgaetrglapalvdrfapeqrvrlpmrp
gnrslnlsntvavvvfeawrqagfegga

Timeline for d4kgng_:

• d4kgng_ first appeared in SCOPe 2.03
  
• d4kgng_ appears in SCOPe 2.06