![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
![]() | Superfamily c.116.1: alpha/beta knot [75217] (9 families) ![]() known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
![]() | Family c.116.1.0: automated matches [191557] (1 protein) not a true family |
![]() | Protein automated matches [190961] (22 species) not a true protein |
![]() | Species Burkholderia pseudomallei [TaxId:425067] [188581] (2 PDB entries) |
![]() | Domain d4kgng_: 4kgn G: [202849] Other proteins in same PDB: d4kgnc2, d4kgnd2, d4kgnf2 automated match to d3e5ya_ complexed with cl, sah |
PDB Entry: 4kgn (more details), 2.15 Å
SCOPe Domain Sequences for d4kgng_:
Sequence, based on SEQRES records: (download)
>d4kgng_ c.116.1.0 (G:) automated matches {Burkholderia pseudomallei [TaxId: 425067]} mfnvvlvepeippntgnvirlcantgarlhlieplgfplddakmrragldyheyaqmrvh rdwdafvaaeapdparmfafttrgsgrfhdrafepgdwfvfgaetrglapalvdrfapeq rvrlpmrpgnrslnlsntvavvvfeawrqagfegga
>d4kgng_ c.116.1.0 (G:) automated matches {Burkholderia pseudomallei [TaxId: 425067]} mfnvvlvepeippntgnvirlcantgarlhlieplgfplgldyheyaqmrvhrdwdafva aeapdparmfafttrgsgrfhdrafepgdwfvfgaetrglapalvdrfapeqrvrlpmrp gnrslnlsntvavvvfeawrqagfegga
Timeline for d4kgng_: