Lineage for d4kafb_ (4kaf B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1382311Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1382312Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1382893Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 1382931Protein automated matches [190880] (3 species)
    not a true protein
  7. 1382945Species Rhodococcus sp. [TaxId:1831] [189207] (7 PDB entries)
  8. 1382949Domain d4kafb_: 4kaf B: [202842]
    automated match to d4kafa_
    complexed with edo, na, peg, scn

Details for d4kafb_

PDB Entry: 4kaf (more details), 1.5 Å

PDB Description: Crystal Structure of Haloalkane dehalogenase HaloTag7 at the resolution 1.5A, Northeast Structural Genomics Consortium (NESG) Target OR151
PDB Compounds: (B:) haloalkane dehalogenase

SCOPe Domain Sequences for d4kafb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kafb_ c.69.1.8 (B:) automated matches {Rhodococcus sp. [TaxId: 1831]}
shmaeigtgfpfdphyvevlgermhyvdvgprdgtpvlflhgnptssyvwrniiphvapt
hrciapdligmgksdkpdlgyffddhvrfmdafiealgleevvlvihdwgsalgfhwakr
nperikgiafmefirpiptwdewpefaretfqafrttdvgrkliidqnvfiegtlpmgvv
rpltevemdhyrepflnpvdreplwrfpnelpiagepanivalveeymdwlhqspvpkll
fwgtpgvlippaeaarlakslpnckavdigpglnllqednpdligseiarwlstleisg

SCOPe Domain Coordinates for d4kafb_:

Click to download the PDB-style file with coordinates for d4kafb_.
(The format of our PDB-style files is described here.)

Timeline for d4kafb_: