SCOP 1.65: Domain d1bvlc_: 1bvl C:

Lineage for d1bvlc_ (1bvl C:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (24 PDB entries)

8. Domain d1bvlc_: 1bvl C: [20284]
   Other proteins in same PDB: d1bvlb_, d1bvld_
   part of humanized anti-lysozyme Fv HuLys11

Details for d1bvlc_

PDB Entry: 1bvl, 2.87 Å

PDB Description: humanized anti-lysozyme fv

SCOP Domain Sequences for d1bvlc_:

Sequence; same for both SEQRES and ATOM records:

>d1bvlc_ b.1.1.1 (C:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
qvqlqesgpglvrpsqtlsltctvsgfsltgygvnwvrqppgrglewigmiwgdgntdyn
salksrvtmlkdtsknqfslrlssvtaadtavyycarerdyrldywgqgslvtvss

Timeline for d1bvlc_:

• d1bvlc_ first appeared (with stable ids) in SCOP 1.55
  
• d1bvlc_ appears in SCOP 1.63
  
• d1bvlc_ appears in SCOP 1.67
  
• d1bvlc_ appears in the current release, SCOPe 2.08, called d1bvlc1