Lineage for d4k64g1 (4k64 G:5-324)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047544Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2047584Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2047688Domain d4k64g1: 4k64 G:5-324 [202837]
    Other proteins in same PDB: d4k64a2, d4k64b_, d4k64c2, d4k64d_, d4k64e2, d4k64f_, d4k64g2, d4k64h_
    automated match to d4k64a_
    complexed with nag

Details for d4k64g1

PDB Entry: 4k64 (more details), 2.6 Å

PDB Description: structure of an avian influenza h5 hemagglutinin from the influenza virus complexed with human receptor analog lstc
PDB Compounds: (G:) Hemagglutinin

SCOPe Domain Sequences for d4k64g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k64g1 b.19.1.2 (G:5-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanptndlcypgsfndyeelkhllsrinhfekiqiipks
swsdheassgvssacpylgspsffrnvvwlikknstyptikksynntnqedllvlwgihh
pndaaeqtrlyqnpttyisigtstlnqrlvpkiatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrns

SCOPe Domain Coordinates for d4k64g1:

Click to download the PDB-style file with coordinates for d4k64g1.
(The format of our PDB-style files is described here.)

Timeline for d4k64g1: