![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.73: Carbamate kinase-like [53632] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest |
![]() | Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) ![]() the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase |
![]() | Family c.73.1.0: automated matches [191466] (1 protein) not a true family |
![]() | Protein automated matches [190728] (15 species) not a true protein |
![]() | Species Giardia lamblia [TaxId:184922] [197259] (5 PDB entries) |
![]() | Domain d4jz7b_: 4jz7 B: [202818] automated match to d4jz7a_ complexed with anp |
PDB Entry: 4jz7 (more details), 2.6 Å
SCOPe Domain Sequences for d4jz7b_:
Sequence, based on SEQRES records: (download)
>d4jz7b_ c.73.1.0 (B:) automated matches {Giardia lamblia [TaxId: 184922]} msagktvvialggnamlqakekgdydtqrknveiaaseiykihkagykvvltsgngpqvg aiklqnqaaagvspemplhvcgamsqgfigymmsqamdnvfcannepancvtcvtqtlvd pkdqaftnptkpvgrfyteqeakdlmaanpgkilredagrgwrvvvpsprpleiveygvi ktlidnnvlvictngggipckrenkvisgvdavidkdlatsllaktlnsdylmiltdvln acinykkpderkleeiklseilalekdghfaagsmgpkvraaieftqatgkmsiitslst avdalngkcgtriikd
>d4jz7b_ c.73.1.0 (B:) automated matches {Giardia lamblia [TaxId: 184922]} msagktvvialggnamlqakekgdydtqrknveiaaseiykihkagykvvltsgngpqvg aiklqnqaaagvspemplhvcgamsqgfigymmsqamdnvfcannepancvtcvtqtlvd pkdqaftnptkpvvvpsprpleiveygviktlidnnvlvictngggipckrenkvisgvd avidkdlatsllaktlnsdylmiltdvlnacinykkpderkleeiklseilalekdghfa agsmgpkvraaieftqatgkmsiitslstavdalngkcgtriikd
Timeline for d4jz7b_: