Lineage for d4jwsb_ (4jws B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005161Protein Cytochrome P450-CAM [48266] (1 species)
  7. 2005162Species Pseudomonas putida [TaxId:303] [48267] (115 PDB entries)
    Uniprot P00183
  8. 2005259Domain d4jwsb_: 4jws B: [202814]
    Other proteins in same PDB: d4jwsc_, d4jwsd_
    automated match to d4jwua_
    complexed with 1n0, ca, fes, hem

Details for d4jwsb_

PDB Entry: 4jws (more details), 2.15 Å

PDB Description: Crystal structure of Cytochrome P450cam-putidaredoxin complex
PDB Compounds: (B:) Camphor 5-monooxygenase

SCOPe Domain Sequences for d4jwsb_:

Sequence, based on SEQRES records: (download)

>d4jwsb_ a.104.1.1 (B:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsngghwiatrgq
lireayedyrhfssespfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelasslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaseellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenaapmhvdfsrqcvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

Sequence, based on observed residues (ATOM records): (download)

>d4jwsb_ a.104.1.1 (B:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrsngghwiatrgq
lireayedyrhfssespfipresmdppeqrqfralanqvvgmpvvdklenriqelassli
eslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdgsmtfaeakea
lydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvggldtvvnflsf
smeflakspehrqelierperipaaseellrrfslvadgriltsdyefhgvqlkkgdqil
lpqmlsglderenaapmhvdfsrqcvshttfghgshlclgqhlarreiivtlkewltrip
dfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d4jwsb_:

Click to download the PDB-style file with coordinates for d4jwsb_.
(The format of our PDB-style files is described here.)

Timeline for d4jwsb_: