Lineage for d4jvub_ (4jvu B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759480Domain d4jvub_: 4jvu B: [202811]
    Other proteins in same PDB: d4jvua2
    automated match to d4jvua_

Details for d4jvub_

PDB Entry: 4jvu (more details), 1.3 Å

PDB Description: IgM C2-domain from mouse
PDB Compounds: (B:) Ig mu chain C region membrane-bound form

SCOPe Domain Sequences for d4jvub_:

Sequence, based on SEQRES records: (download)

>d4jvub_ b.1.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
emnpnvnvfvpprdgfsgpaprkskliceatnftpkpitvswlkdgklvesgfttdpvti
enkgstpqtykvistltiseidwlnlnvytcrvdhrgltflknvsstca

Sequence, based on observed residues (ATOM records): (download)

>d4jvub_ b.1.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
emnpnvnvfvpprdgfkskliceatnftpkpitvswlkdgklvesgfttdpvtieqtykv
istltiseidwlnlnvytcrvdhrgltflknvsstca

SCOPe Domain Coordinates for d4jvub_:

Click to download the PDB-style file with coordinates for d4jvub_.
(The format of our PDB-style files is described here.)

Timeline for d4jvub_: